SOX9

SOX9
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

4EUW

Ідентифікатори
Символи SOX9, CMD1, CMPD1, SRA1, SRXX2, SRXY10, SRY-box 9, SRY-box transcription factor 9
Зовнішні ІД OMIM: 608160 MGI: 98371 HomoloGene: 294 GeneCards: SOX9
Онтологія гена
Молекулярна функція

GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
core promoter sequence-specific DNA binding
protein kinase activity
protein kinase A catalytic subunit binding
beta-catenin binding
pre-mRNA intronic binding
chromatin binding
GO:0001948, GO:0016582 protein binding
DNA binding
sequence-specific DNA binding
GO:0000975 transcription cis-regulatory region binding
bHLH transcription factor binding
GO:0001158 cis-regulatory region sequence-specific DNA binding
protein heterodimerization activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding

Клітинна компонента

клітинне ядро
transcription regulator complex
нуклеоплазма
GO:0009327 protein-containing complex

Біологічний процес

skeletal system development
cellular response to retinoic acid
bronchus cartilage development
positive regulation of protein phosphorylation
heart valve development
limb bud formation
GO:1903364 positive regulation of protein catabolic process
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
ureter morphogenesis
negative regulation of immune system process
chondrocyte development
positive regulation of cell proliferation involved in heart morphogenesis
oligodendrocyte differentiation
chondrocyte hypertrophy
prostate gland development
lung smooth muscle development
mammary gland development
negative regulation of ossification
negative regulation of photoreceptor cell differentiation
cellular response to mechanical stimulus
intrahepatic bile duct development
regulation of cell adhesion
negative regulation of chondrocyte differentiation
positive regulation of mesenchymal cell proliferation
astrocyte fate commitment
positive regulation of chondrocyte differentiation
Сперматогенез
prostate gland morphogenesis
negative regulation of epithelial cell proliferation
lung epithelial cell differentiation
chondrocyte differentiation involved in endochondral bone morphogenesis
negative regulation of canonical Wnt signaling pathway
endocrine pancreas development
negative regulation of cell population proliferation
regulation of apoptotic process
cellular response to transforming growth factor beta stimulus
negative regulation of mesenchymal cell apoptotic process
ремоделювання хроматину
negative regulation of myoblast differentiation
positive regulation of branching involved in ureteric bud morphogenesis
cell fate commitment
GO:0009373 regulation of transcription, DNA-templated
epidermal growth factor receptor signaling pathway
осифікація
regulation of cell proliferation involved in tissue homeostasis
ureter smooth muscle cell differentiation
ERK1 and ERK2 cascade
notochord development
positive regulation of epithelial cell migration
Sertoli cell differentiation
male sex determination
negative regulation of gene expression
transcription, DNA-templated
metanephric nephron tubule formation
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
heart development
regulation of branching involved in lung morphogenesis
ureter urothelium development
branching involved in ureteric bud morphogenesis
cartilage development
Harderian gland development
positive regulation of kidney development
central nervous system development
heart valve formation
positive regulation of cartilage development
tissue homeostasis
metanephric tubule development
negative regulation of biomineral tissue development
endochondral bone morphogenesis
trachea cartilage development
male germ-line sex determination
lacrimal gland development
Сигнальний шлях Notch
hair follicle development
диференціація клітин
ureter development
regulation of cell cycle process
male gonad development
positive regulation of epithelial cell proliferation
cell fate specification
intestinal epithelial structure maintenance
positive regulation of extracellular matrix assembly
extracellular matrix organization
negative regulation of apoptotic process
GO:1901227 negative regulation of transcription by RNA polymerase II
Sertoli cell development
positive regulation of mesenchymal stem cell differentiation
retina development in camera-type eye
cellular response to interleukin-1
Епітеліально-мезенхімальний перехід
homeostasis of number of cells within a tissue
GO:0045996 negative regulation of transcription, DNA-templated
cAMP-mediated signaling
cartilage condensation
positive regulation of male gonad development
nucleosome assembly
negative regulation of bone mineralization
morphogenesis of a branching epithelium
neural crest cell development
protein kinase B signaling
somatic stem cell population maintenance
otic vesicle formation
otic vesicle development
endocardial cushion morphogenesis
cellular response to epidermal growth factor stimulus
positive regulation of epithelial cell differentiation
renal vesicle induction
GO:1901313 positive regulation of gene expression
regulation of epithelial cell proliferation involved in lung morphogenesis
regulation of cell population proliferation
heart valve morphogenesis
cytoskeleton organization
cochlea morphogenesis
positive regulation of cell population proliferation
epithelial cell proliferation involved in prostatic bud elongation
retinal rod cell differentiation
protein localization to nucleus
регуляція диференціювання клітин
positive regulation of phosphatidylinositol 3-kinase signaling
cellular response to heparin
negative regulation of epithelial cell differentiation
epithelial tube branching involved in lung morphogenesis
GO:0072468 сигнальна трансдукція
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of pri-miRNA transcription by RNA polymerase II
chondrocyte differentiation
neural crest cell fate specification
cellular response to BMP stimulus
cell-cell adhesion
transcription initiation from RNA polymerase II promoter
GO:0034622 protein-containing complex assembly
anterior head development
morphogenesis of an epithelium
aortic valve morphogenesis
регуляція експресії генів

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
6662
20682
Ensembl
ENSG00000125398
ENSMUSG00000000567
UniProt
P48436
Q04887
RefSeq (мРНК)
NM_000346
NM_011448
RefSeq (білок)
NP_000337
NP_035578
Локус (UCSC) Хр. 17: 72.12 – 72.13 Mb Хр. 11: 112.67 – 112.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SOX9 (англ. SRY-box 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 509 амінокислот, а молекулярна маса — 56 137[4].

Послідовність амінокислот
1020304050
MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQE
NTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSK
NKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESE
KRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISP
NAIFKALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKA
DLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPP
NGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP
QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTE
QLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSS
YYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQ
PVYTQLTRP

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Cox J.J., Willatt L., Homfray T., Woods C.G. (2011). A SOX9 duplication and familial 46,XX developmental testicular disorder. N. Engl. J. Med. 364: 91—93. PMID 21208124 DOI:10.1056/NEJMc1010311
  • Cameron F.J., Sinclair A.H. (1997). Mutations in SRY and SOX9: testis-determining genes. Hum. Mutat. 9: 388—395. PMID 9143916 DOI:10.1002/(SICI)1098-1004(1997)9:5<388::AID-HUMU2>3.0.CO;2-0
  • Thong M.-K., Scherer G., Kozlowski K., Haan E., Morris L. (2000). Acampomelic campomelic dysplasia with SOX9 mutation. Am. J. Med. Genet. 93: 421—425. PMID 10951468 DOI:10.1002/1096-8628(20000828)93:5<421::AID-AJMG14>3.3.CO;2-X
  • Moog U., Jansen N.J., Scherer G., Schrander-Stumpel C.T. (2001). Acampomelic campomelic syndrome. Am. J. Med. Genet. 104: 239—245. PMID 11754051 DOI:10.1002/ajmg.10033

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:11204 (англ.) . Архів оригіналу за 11 липня 2017. Процитовано 12 вересня 2017.
  4. UniProt, P48436 (англ.) . Архів оригіналу за 22 серпня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 17
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

 
Фактори транскрипції та внутрішньоклітинні рецептори
 
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
 
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
 
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
 
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
 
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші